Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH 3IN8 Chain:A ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3IN8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 277 -38931 -140.55 -512.25 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -140.55 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.819

(partial model without unconserved sides chains): PDB file : Tito_3IN8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IN8-query.scw PDB file : Tito_Scwrl_3IN8.pdb: