Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYY 4OHH Chain:A ((6-113)) WFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYY

General information: TITO was launched using: RESULT: Template: 4OHH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 299 -36630 -122.51 -481.97 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -122.51 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.660

(partial model without unconserved sides chains): PDB file : Tito_4OHH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OHH-query.scw PDB file : Tito_Scwrl_4OHH.pdb: