Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDHH 2DCR Chain:A ((18-87)) WYHGAIPRAEVAELLVHSGDFLVRES-QGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDH-

General information: TITO was launched using: RESULT: Template: 2DCR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 240 -34878 -145.32 -498.25 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -145.32 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.609

(partial model without unconserved sides chains): PDB file : Tito_2DCR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DCR-query.scw PDB file : Tito_Scwrl_2DCR.pdb: