Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELVLPNNYVVIDEEEMMYLDGGAIYIPRWAITGAITGAAYAALAAAGGGGLQLVLASYGLRSALVAGIVKGLGVLGIHIGNAFANTVIRSIASAGIGAGADWIFTNIIDGWDGRRDNQLRIG 1AYO Chain:A ((44-64)) VDVKMVSGFIPLKPTVKMLER------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1AYO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 11 -3909 -355.36 -186.14 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : -355.36 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.250

(partial model without unconserved sides chains): PDB file : Tito_1AYO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1AYO-query.scw PDB file : Tito_Scwrl_1AYO.pdb: