Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGSSENCPVLFYFEKIWSLSL---KLLDCILDYQERFNGKTCQVSTNYKYLETFKVNFCLTDLHHLFDLYKITRDY-ASQTKPAIQAGVFILEDFRNILCTMM 1C1K Chain:A ((84-161)) --------------DAWIGDISDADALVFYREYIGRLKQIKFKFEEDIRNIYYFSKKVEVSAFKEIF---EYNPKVQSSYIFKLLQSNIISFETF--------

General information: TITO was launched using: RESULT: Template: 1C1K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 130 -3649 -28.07 -49.31 target 2D structure prediction score : 0.24 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -28.07 2D Compatibility (Sec. Struct. Predict.) : 0.24 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.083

(partial model without unconserved sides chains): PDB file : Tito_1C1K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1C1K-query.scw PDB file : Tito_Scwrl_1C1K.pdb: