Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHLTHREVRDKLLSYSEGLQVYYELYQLLLFHFQEKNADHFFGLIEQELPTVHPLFQTVFWTFLRDRDKIINALKLPYSNAKLEATNNLIKVIKRKAFGFRNFNNFKKRILMTLNIKKESTNFVLSRL 1G28 Chain:A ((61-104)) ----QRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIG-VQQEM-------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1G28.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 104 -4927 -47.38 -111.98 target 2D structure prediction score : 0.14 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -47.38 2D Compatibility (Sec. Struct. Predict.) : 0.14 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.049

(partial model without unconserved sides chains): PDB file : Tito_1G28.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1G28-query.scw PDB file : Tito_Scwrl_1G28.pdb: