Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMAKD-DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK
5LMP Chain:W ((2-71))-AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYR--


General information:
TITO was launched using:
RESULT:

Template: 5LMP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 272 510 1.87 7.38
target 2D structure prediction score : 0.57
Monomeric hydrophicity matching model chain W : 0.87

3D Compatibility (PKB) : 1.87
2D Compatibility (Sec. Struct. Predict.) : 0.57
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.656

(partial model without unconserved sides chains):
PDB file : Tito_5LMP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5LMP-query.scw
PDB file : Tito_Scwrl_5LMP.pdb: