Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPFVRIDLFEGRTLEQKKALAKEVTEAVVRNTGAPQSAVHVIINDMPEGTYFPQGEMRTK 4FAZ Chain:A ((1-50)) -PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENW---------

General information: TITO was launched using: RESULT: Template: 4FAZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 125 -17754 -142.03 -355.07 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -142.03 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.864

(partial model without unconserved sides chains): PDB file : Tito_4FAZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4FAZ-query.scw PDB file : Tito_Scwrl_4FAZ.pdb: