Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKLARESVRTTRLY 4WB7 Chain:A ((43-95)) -----------------KFKEIAEAYDVLSDPRKREIFDRYGEEVKEFLAKAKEDFLKKWESPAQNTAHL-

General information: TITO was launched using: RESULT: Template: 4WB7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 19 -786 -41.34 -14.82 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -41.34 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.743

(partial model without unconserved sides chains): PDB file : Tito_4WB7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WB7-query.scw PDB file : Tito_Scwrl_4WB7.pdb: