Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKKGSFMPASTSQYYTRTAQILHWVMAIIFITAWVIGFYSGNFLSYD-VDGSFKGDVITLHKNIATTIIFLVVIRLFWRYTHPAPQLPDTMSPTMKTLAHIGHLLLYVILVALPVTGCLFSWSAGHPAPVLYLFEIPRLVQDNPELLAIVKPLHIYISWFAGFLIVGHVLAALKHHFVDKDNVLNSMTKQPK 1KQF Chain:C ((105-175)) -----------DVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFW---------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1KQF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 138 -30596 -221.71 -437.09 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain C : 0.52 3D Compatibility (PKB) : -221.71 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.413

(partial model without unconserved sides chains): PDB file : Tito_1KQF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KQF-query.scw PDB file : Tito_Scwrl_1KQF.pdb: