Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKSELIDAIAEKGGVSKTDAGKALDATIASITEALKKGDTVTLVGFGTFSVKERAARTGRNPKTGEELQIKATKVPSFKAGKGLKDSVA 4YEY Chain:A ((2-90)) MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHR------------------ANVPAFVSGKALKDAV-

General information: TITO was launched using: RESULT: Template: 4YEY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 168 -14312 -85.19 -201.58 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.88 3D Compatibility (PKB) : -85.19 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.606

(partial model without unconserved sides chains): PDB file : Tito_4YEY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YEY-query.scw PDB file : Tito_Scwrl_4YEY.pdb: