Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWYFAWILGILMACFAGVLSALYIEHHQNLDEE 3FHP Chain:A ((1-21)) --------GIVEQCCTSICSLYQLENYCN----

General information: TITO was launched using: RESULT: Template: 3FHP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 23 -7227 -314.20 -344.12 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -314.20 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.462

(partial model without unconserved sides chains): PDB file : Tito_3FHP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FHP-query.scw PDB file : Tito_Scwrl_3FHP.pdb: