Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQVQDPTFWGGNIAFWIQTLVFFISALIAIYTLRRNEAQAKKRATVDLVLSETQDMYFRDIKEKFGKYK 2KV5 Chain:A ((12-31)) ----------------------IFVGLVLEMISRVLDEEDDS----------------------------

General information: TITO was launched using: RESULT: Template: 2KV5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 6 -221 -36.83 -11.05 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -36.83 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.370

(partial model without unconserved sides chains): PDB file : Tito_2KV5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KV5-query.scw PDB file : Tito_Scwrl_2KV5.pdb: