Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLELIMRIEMKTSDVLARFN-APKIAKLLKISRQAVYQWGE--FVPEAAAFKLLEQEPTLPVKRVS 2HIN Chain:B ((1-50)) ----------MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAY-------

General information: TITO was launched using: RESULT: Template: 2HIN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 152 -2932 -19.29 -62.38 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain B : 0.64 3D Compatibility (PKB) : -19.29 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.820

(partial model without unconserved sides chains): PDB file : Tito_2HIN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HIN-query.scw PDB file : Tito_Scwrl_2HIN.pdb: