Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFFRIFTIFLLILSTNIEAKEKLITGEKIASSYKLLQSMTIPAIYENGMVLTKYANLYKMDNQCVIVSKLDNESNFGGYEDIIYFKNGIMLRSSKQSFFSIFLDDEAKIKSKEIKYGDFLNGKEVQKGLKEDFIQYRKKFNKYTLSKCS 5JL7 Chain:A ((172-212)) ------------------------------------------------------------------LDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESA------------------------------------------

General information: TITO was launched using: RESULT: Template: 5JL7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 59 4619 78.29 112.66 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : 78.29 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.044

(partial model without unconserved sides chains): PDB file : Tito_5JL7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JL7-query.scw PDB file : Tito_Scwrl_5JL7.pdb: