Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLQIKAKEEITMAKVCYFTGRKTKSGNNRSHAMNSTKRTVKPNLQKVRVMVDGKPKKVWVSTRALKSGKVERV 5GAD Chain:Y ((2-47)) ------------SRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFV---------------

General information: TITO was launched using: RESULT: Template: 5GAD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Y - contact count / total energy / energy per contact / energy per residue : 79 5129 64.92 111.50 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain Y : 0.73 3D Compatibility (PKB) : 64.92 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.314

(partial model without unconserved sides chains): PDB file : Tito_5GAD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5GAD-query.scw PDB file : Tito_Scwrl_5GAD.pdb: