Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPLAIMASEDHSGLIQAVESSDVTYLTKFPGVGKKTAQQMILDLKGKFGELSID--TPFSLFDEANTKDATALSEAMEALSALGYSDREIKRVEKQLKEVDNQTTDEYLRQALKLMMKK 1D8L Chain:A ((85-140)) LALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLF---------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1D8L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 130 -24129 -185.61 -446.83 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -185.61 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.599

(partial model without unconserved sides chains): PDB file : Tito_1D8L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1D8L-query.scw PDB file : Tito_Scwrl_1D8L.pdb: