Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFKGVLFDLDGVITDTAEFHYRAWRKLGQEIGIT-IDHTFNEQLKGVSREDSLSLLLAYGGKEHSFSKEEFAELAKRKNDYYLEMIQTIEPKDVFPGVVPLLDSLKEEKIKIALASASKNGPFLLEKMGLTPYFDAIADPAEATNGKPAPDIFLLAAKAVGLKAEECIGIEDAQAGIQAILSSGAQPIGVGRAEDLGEEIPLVPDTTFLTIDYLKEKWHDHG
2WF6 Chain:A ((1-216))MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKK--VSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVW----


General information:
TITO was launched using:
RESULT:

Template: 2WF6.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1135 2816 2.48 13.10
target 2D structure prediction score : 0.63
Monomeric hydrophicity matching model chain A : 0.92

3D Compatibility (PKB) : 2.48
2D Compatibility (Sec. Struct. Predict.) : 0.63
1D Compatibility (Hydrophobicity) : 0.92
QMean score : 0.669

(partial model without unconserved sides chains):
PDB file : Tito_2WF6.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2WF6-query.scw
PDB file : Tito_Scwrl_2WF6.pdb: