Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHY
1O4J Chain:A ((7-89))WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY


General information:
TITO was launched using:
RESULT:

Template: 1O4J.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 298 -46187 -154.99 -556.47
target 2D structure prediction score : 0.78
Monomeric hydrophicity matching model chain A : 0.84

3D Compatibility (PKB) : -154.99
2D Compatibility (Sec. Struct. Predict.) : 0.78
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.681

(partial model without unconserved sides chains):
PDB file : Tito_1O4J.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1O4J-query.scw
PDB file : Tito_Scwrl_1O4J.pdb: