Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1O4M Chain:A ((7-89)) WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY

General information: TITO was launched using: RESULT: Template: 1O4M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 262 -5480 -20.92 -70.26 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.85 3D Compatibility (PKB) : -20.92 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.646

(partial model without unconserved sides chains): PDB file : Tito_1O4M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1O4M-query.scw PDB file : Tito_Scwrl_1O4M.pdb: