Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHY
1O4I Chain:A ((7-89))WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY


General information:
TITO was launched using:
RESULT:

Template: 1O4I.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 298 -38166 -128.07 -459.83
target 2D structure prediction score : 0.70
Monomeric hydrophicity matching model chain A : 0.87

3D Compatibility (PKB) : -128.07
2D Compatibility (Sec. Struct. Predict.) : 0.70
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.643

(partial model without unconserved sides chains):
PDB file : Tito_1O4I.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1O4I-query.scw
PDB file : Tito_Scwrl_1O4I.pdb: