Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPFVRIDLFEGRTLEQKKALAKEVTEAVVRNTGAPQSAVHVIINDMPEGTYFPQGEMRTK 4FAZ Chain:B ((1-59)) -PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENWGIGGVSAKA

General information: TITO was launched using: RESULT: Template: 4FAZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 159 -18380 -115.60 -311.53 target 2D structure prediction score : 0.90 Monomeric hydrophicity matching model chain B : 0.81 3D Compatibility (PKB) : -115.60 2D Compatibility (Sec. Struct. Predict.) : 0.90 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.701

(partial model without unconserved sides chains): PDB file : Tito_4FAZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4FAZ-query.scw PDB file : Tito_Scwrl_4FAZ.pdb: