Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY
1O4D Chain:A ((7-89))WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY


General information:
TITO was launched using:
RESULT:

Template: 1O4D.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 254 -3468 -13.65 -44.46
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain A : 0.85

3D Compatibility (PKB) : -13.65
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.85
QMean score : 0.652

(partial model without unconserved sides chains):
PDB file : Tito_1O4D.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1O4D-query.scw
PDB file : Tito_Scwrl_1O4D.pdb: