Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSRVARYHADRTNQKLYFARLACQQAEQTDHVQQVQAYREAAVFHLHGAMLAFLQELVRYYRLNDLQPTLKSIEEHMAAKGQVSPEVSVLQQLAKDGFVAELKRAYRMCQYAPEPTEPTPEEEISSNLIIKVTQGPQSWLPDVKILREWHRELSHLIDGFHNEMVEF 3N9I Chain:A ((280-345)) ---------------------------------QMYGHLKGAVADAVSGMLSELQERYRTYRED--EALLQDVMREGAAKARARAQVTLAKVYEAIGFVAQ------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3N9I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 32 -2078 -64.94 -31.48 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -64.94 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.419

(partial model without unconserved sides chains): PDB file : Tito_3N9I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3N9I-query.scw PDB file : Tito_Scwrl_3N9I.pdb: