Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKSFAINMAPTN-HGGM----IPATQSRTSQEGNLFVRAGDGHMC---PKCKC-WSVVIKSHDHVIMDGKPVAYVGDKLSCGATIMPQQFHVVGDSGSPYSSAAPVQNSLVEDKSNEIHKVQFKLVDVDTDQPLSAMLYEIHSKESGKLLVQGYTDKNGMTAIYESEHTPESVQLITIDLSKPLDPL 4JIV Chain:D ((1-86)) --GNGIVVGHLGTDHDGFPPTPVTAGSATVRYDGIPAARLGDPLAPHDKPKHPSHGRAIAAGSGTVMIDGKPAARVGDAVDCGGVLQG----------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4JIV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 326 -2113 -6.48 -27.44 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain D : 0.61 3D Compatibility (PKB) : -6.48 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.266

(partial model without unconserved sides chains): PDB file : Tito_4JIV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4JIV-query.scw PDB file : Tito_Scwrl_4JIV.pdb: