Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------MNEKFIQLSKELKHRPILEKALGYFPNLPLVAIDCGCGAGNESAY-LLSKGFNVHAFDISIDAQKVCTERFKDDSKFIFYHE-SFEDFNFP-SASLIIASSSLFFCNPSYFYSVIKRMINALSEGGILVVDLLGIYDEWVIREPTKFIGFTYQDIADLFLCDFNLLFHKEINENLPLLEGYIKTWHLHMLILQKSDF
3E23 Chain:A ((7-204))QAFDDDTLRFYRGNATAYAERQPRSATLTKFLGELPA-GAKILELGCGAGYQAEAML-AAGFDVDATDGSPELAAEASRRLGRPVR-----TMLFHQLDAIDAYDAVWAHACLLHVPRDELADVLKLIWRALKPGGLFYASYKSGEGEGRDKLARYYNYPSEEWLRARYAEAGTWASVAVESSEGKGFDQELAQFLH--VSVRKPEL


General information:
TITO was launched using:
RESULT:

Template: 3E23.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 928 1327 1.43 7.17
target 2D structure prediction score : 0.62
Monomeric hydrophicity matching model chain A : 0.66

3D Compatibility (PKB) : 1.43
2D Compatibility (Sec. Struct. Predict.) : 0.62
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.487

(partial model without unconserved sides chains):
PDB file : Tito_3E23.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3E23-query.scw
PDB file : Tito_Scwrl_3E23.pdb: