Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMTQFVHYQNKQPRDNRRNVNLNDSETMLFDAMSRITGTPIAIIIREFALRHAIRLIMDTDQSILDRIMNTGAPEHLQRG 1P94 Chain:B ((30-71)) ----------SSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNW----------------------------

General information: TITO was launched using: RESULT: Template: 1P94.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 49 -8133 -165.98 -193.64 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain B : 0.63 3D Compatibility (PKB) : -165.98 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.627

(partial model without unconserved sides chains): PDB file : Tito_1P94.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1P94-query.scw PDB file : Tito_Scwrl_1P94.pdb: