Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLFKKFAVAAAVAATLAFVGCSKKEEAPAAASEAVAAASEATAAAAAASEAAAAAASEAAVAVDAAASETAAASEAAAAH 5NZT Chain:G ((264-380)) ----EMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPKAALRYAAVRTLNKVAMKHPSAVTA---------------

General information: TITO was launched using: RESULT: Template: 5NZT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 158 -10110 -63.99 -165.74 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain G : 0.70 3D Compatibility (PKB) : -63.99 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.430

(partial model without unconserved sides chains): PDB file : Tito_5NZT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5NZT-query.scw PDB file : Tito_Scwrl_5NZT.pdb: