Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------------------------------------MSLPFHSESQG---AISKNSFSCLLNIVTGDRGAGRRTP-------FIGEVVKKLF-CIK-------------------------------------------------------------------------------------- 5EE5 Chain:A ((6-210)) EGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAATLTQMLNVIFARMENQALQEAKQMEKERHR

General information: TITO was launched using: RESULT: Template: 5EE5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 73 2640 36.16 53.87 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 36.16 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.310

(partial model without unconserved sides chains): PDB file : Tito_5EE5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EE5-query.scw PDB file : Tito_Scwrl_5EE5.pdb: