Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------METKCDFMVNRAILIE---MGFKPSQAARMIKESKAYLARIEGIDFYNNRQVGVVPSRVIEHLFHIQVAE-----------------------------
5AN3 Chain:A ((3-134))VEKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWHSDATMENAKELLDKALMTAEGDRSKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYVDDTLPLWEDRLETK


General information:
TITO was launched using:
RESULT:

Template: 5AN3.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 220 -2058 -9.35 -30.71
target 2D structure prediction score : 0.54
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : -9.35
2D Compatibility (Sec. Struct. Predict.) : 0.54
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.352

(partial model without unconserved sides chains):
PDB file : Tito_5AN3.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5AN3-query.scw
PDB file : Tito_Scwrl_5AN3.pdb: