Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence RRMCMLALAETTENPETPNFIHGTLQEVQAPTAASISYGGHYIHLKLDKNCLPKLVQGSSVPPGYSVHIFSKGSDKYTPTSVVIEGT--EVQELPGFDPRGSVDFYERLVGLSRS 1QQO Chain:A ((167-235)) ------------------------LRIINSPTAAAIAYG-------LDK----------AVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV-----

General information: TITO was launched using: RESULT: Template: 1QQO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 214 -5842 -27.30 -87.19 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -27.30 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.365

(partial model without unconserved sides chains): PDB file : Tito_1QQO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1QQO-query.scw PDB file : Tito_Scwrl_1QQO.pdb: