Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence TQKCIITIRKADPALGQDTLYDLVSLAPNSDLTFGKIPASMTEVTFGVDEKCQARLVRGDLSRPYE----YKGMQNPLYGLDGPDFVKKLQAWRRKPENSINFSLW 1H6K Chain:X ((38-118)) -KSCTLYVGNLSFYTTEEQIYELFS-------KSGDI----KKIIMGLDKMCGFCFVE--YYSRADAENAMRYING--TRLDD----RII---------RTDWDAG

General information: TITO was launched using: RESULT: Template: 1H6K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 307 -49530 -161.33 -678.49 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain X : 0.70 3D Compatibility (PKB) : -161.33 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.500

(partial model without unconserved sides chains): PDB file : Tito_1H6K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1H6K-query.scw PDB file : Tito_Scwrl_1H6K.pdb: