Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------GCPYSIKRYGEEVKWDIIEAGTSHIRVVNGI--------GATIIAKKNCKLS----------------LKGLPRFEYTISRGDSINRQS----------------------------------------------------------------------------------------------- 4B8V Chain:A ((36-224)) CGSTSNIKYTVVKGDTLTSIAKKFK-----SGICNIVSVNKLANPNLIELGATLIIPENCSNPDNKSCVSTPAEPTETCVPGLPG-SYTIVSGDTLTNISQDFNITLDSLIAANTQIENPDAIDVGQIITVPVCPSSQCEAVGTYNIVAGDLFVDLAATYHTTIGQIKALNNNVNPSKLKVGQQIILPQDCKNVT

General information: TITO was launched using: RESULT: Template: 4B8V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 238 -12222 -51.35 -207.15 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -51.35 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.313

(partial model without unconserved sides chains): PDB file : Tito_4B8V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4B8V-query.scw PDB file : Tito_Scwrl_4B8V.pdb: