Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KKGDCFMGLYEAGGRNPNHIIGQETPDDSGIFELRRENGSVIQVKVKKCQLVAYWGWVPLGQELRVFPSVGYDAKRKTAPLPSLSPNRHSGQGLKVRGANTWIAF---- 3C5X Chain:C ((1-81)) ------FHLTTRNG-EPHMIVSRQEKGKS--LLFKTEDG------VNMCTLMAM----DLGELCEDTITYKC---------PLLRQNEPEDIDCWCNSTSTWVTYGTCT

General information: TITO was launched using: RESULT: Template: 3C5X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 302 -36986 -122.47 -480.33 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain C : 0.67 3D Compatibility (PKB) : -122.47 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.209

(partial model without unconserved sides chains): PDB file : Tito_3C5X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C5X-query.scw PDB file : Tito_Scwrl_3C5X.pdb: