Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DCYIERLQKEHMLSGMKAEPNKEAWIDGFEIWVYSNCRIHPTILPDGSIANGRFWS 2MYV Chain:A ((25-80)) DCIIQRYKDGDVNNIYTANRNEEITIEEYKVFVNEACHPYPVILPDRSVLSGDFTS

General information: TITO was launched using: RESULT: Template: 2MYV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 245 -26217 -107.01 -468.15 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : -107.01 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.143

(partial model without unconserved sides chains): PDB file : Tito_2MYV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MYV-query.scw PDB file : Tito_Scwrl_2MYV.pdb: