Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFY
3M7F Chain:A ((435-516))WFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFY


General information:
TITO was launched using:
RESULT:

Template: 3M7F.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 0 0 NaN 0.00
target 2D structure prediction score : 0.77
Monomeric hydrophicity matching model chain A : 1.00

3D Compatibility (PKB) : NaN
2D Compatibility (Sec. Struct. Predict.) : 0.77
1D Compatibility (Hydrophobicity) : 1.00
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_3M7F.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3M7F-query.scw
PDB file : Tito_Scwrl_3M7F.pdb: