Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence EFHGIISREQADELL-GGVEGAYILRESQRQPGCYTLALRDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHL 4EIH Chain:A ((15-89)) -YHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTA-DGKVYVTAESRFSTLAELVHHH

General information: TITO was launched using: RESULT: Template: 4EIH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 261 -23895 -91.55 -322.91 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -91.55 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.385

(partial model without unconserved sides chains): PDB file : Tito_4EIH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4EIH-query.scw PDB file : Tito_Scwrl_4EIH.pdb: