Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHY 2GSB Chain:A ((18-93)) WFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHY

General information: TITO was launched using: RESULT: Template: 2GSB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 271 -53079 -195.86 -698.41 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -195.86 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.659

(partial model without unconserved sides chains): PDB file : Tito_2GSB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GSB-query.scw PDB file : Tito_Scwrl_2GSB.pdb: