Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYF 3MAZ Chain:A ((18-96)) CFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYF

General information: TITO was launched using: RESULT: Template: 3MAZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 281 -50734 -180.55 -642.20 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -180.55 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.797

(partial model without unconserved sides chains): PDB file : Tito_3MAZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3MAZ-query.scw PDB file : Tito_Scwrl_3MAZ.pdb: