Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGG-VLILIMLLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKYYYSKSREKVYTIPDLLQR 5L7D Chain:A ((364-422)) ----------------------------KNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSARRQLADLEDNWETLND--------------------------------------------

General information: TITO was launched using: RESULT: Template: 5L7D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 18 -1064 -59.11 -21.28 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -59.11 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.458

(partial model without unconserved sides chains): PDB file : Tito_5L7D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5L7D-query.scw PDB file : Tito_Scwrl_5L7D.pdb: