Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGIYPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR 1Q5T Chain:A ((14-53)) --------------------------------GKEAVHSYAIYGCYCGWGGQGRAQD--ATDRCCFAQDCCYGR---

General information: TITO was launched using: RESULT: Template: 1Q5T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 101 -2141 -21.19 -53.51 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -21.19 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.290

(partial model without unconserved sides chains): PDB file : Tito_1Q5T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Q5T-query.scw PDB file : Tito_Scwrl_1Q5T.pdb: