Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPD-GRVAGLSKLARTVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVIIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLMGL
4UQF Chain:E ((5-187))-DKQKIADAVKVILEAVGENPDREGLIDTPMRVARMYEEVFAGLKKDPSVHFDTIFEEQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLARVVDDVSRRPQLQERITTTVAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALIK-


General information:
TITO was launched using:
RESULT:

Template: 4UQF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 0 0 NaN 0.00
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain E : 0.86

3D Compatibility (PKB) : NaN
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.86
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_4UQF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4UQF-query.scw
PDB file : Tito_Scwrl_4UQF.pdb: