Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSDVEKLRDEALALGMT 5EU0 Chain:B ((18-52)) --------------------KRREAVDAAISTHAIEGITLHSKTLEILEGYAKGE---

General information: TITO was launched using: RESULT: Template: 5EU0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 55 -6234 -113.34 -178.10 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -113.34 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.721

(partial model without unconserved sides chains): PDB file : Tito_5EU0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EU0-query.scw PDB file : Tito_Scwrl_5EU0.pdb: