Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLSKNVEYKGGAMSMIEVSHLSKSFGDKIALNNISFTVKEG 4YER Chain:B ((5-67)) --------------IIVVENLVKKFGDFEAVKGVSFSVKKG

General information: TITO was launched using: RESULT: Template: 4YER.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 48 -4997 -104.10 -185.07 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain B : 0.70 3D Compatibility (PKB) : -104.10 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.623

(partial model without unconserved sides chains): PDB file : Tito_4YER.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YER-query.scw PDB file : Tito_Scwrl_4YER.pdb: