Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------MGRNPKTRPEERTELERLQAENEYLRAENAILKKLRELRLKEEKEKEERQK----LFKN 5KTF Chain:A ((1-73)) GSKIEPVVLPLLWFEQSGAMGGKPLSTFYTQLVLMPQVLHYAQYVLLGLGGLLLLVPIICQLRSQEKCFLFWS

General information: TITO was launched using: RESULT: Template: 5KTF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 38 -2289 -60.22 -41.61 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -60.22 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.774

(partial model without unconserved sides chains): PDB file : Tito_5KTF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5KTF-query.scw PDB file : Tito_Scwrl_5KTF.pdb: