Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTLNNLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVTGGSILYRQRGTHIYPGVNVGRGGDDTLFAKVEGVVRFERKGRDKKQVSVYPIAK 5O60 Chain:X ((8-85)) ---------------SSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDDTLFALAPGAVEFGAK-RGRKTVNIVPVAR

General information: TITO was launched using: RESULT: Template: 5O60.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 294 -19909 -67.72 -255.24 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain X : 0.81 3D Compatibility (PKB) : -67.72 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.687

(partial model without unconserved sides chains): PDB file : Tito_5O60.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5O60-query.scw PDB file : Tito_Scwrl_5O60.pdb: