Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMSSKDSKCYT-KLLTSYFK----PRDSHKKGKSYKNSLSEEKEASTTGVNYY---------------QLKTTVFTLN------- 2QSB Chain:A ((5-89)) VRVDQNLFNEVMYLLDELSQDITVPKNVRKVAQDSKAKLSQENESLDLRCATVLSMLDEMANDPNVPAHGRTDLYTIISKLEALS

General information: TITO was launched using: RESULT: Template: 2QSB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 110 16050 145.91 276.72 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 145.91 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.339

(partial model without unconserved sides chains): PDB file : Tito_2QSB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QSB-query.scw PDB file : Tito_Scwrl_2QSB.pdb: