Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLKKYFSKYKWTDLFWILFVILTCLYIGNHDLFTLNHQEFSFRGSVWGLVLALYHLLFIDKFVISNRK 1F2N Chain:C ((92-105)) --ARCYSMWKPTRWDV----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1F2N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 1 -206 -206.00 -14.71 target 2D structure prediction score : 0.00 Monomeric hydrophicity matching model chain C : 0.43 3D Compatibility (PKB) : -206.00 2D Compatibility (Sec. Struct. Predict.) : 0.00 1D Compatibility (Hydrophobicity) : 0.43 QMean score : 0.653

(partial model without unconserved sides chains): PDB file : Tito_1F2N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F2N-query.scw PDB file : Tito_Scwrl_1F2N.pdb: