Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDNSKRPINQIIARINDAAKHGEALVLTAEEVK---ILSKDIGDKVFIPVLTNEQVVQLVKEGKLGQKIK 3BHP Chain:B ((3-38)) -------SNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYL---------------------------

General information: TITO was launched using: RESULT: Template: 3BHP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 50 -2257 -45.13 -68.38 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : -45.13 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.689

(partial model without unconserved sides chains): PDB file : Tito_3BHP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BHP-query.scw PDB file : Tito_Scwrl_3BHP.pdb: