Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSKLSVDISASARNGVSRILHGLDISNQKEIAEQLKVDPSTINRLKTDKKTMV-----------------------------------------------------------------------------------------------------------------------------------------------------
1ZKG Chain:A ((13-211))VLSKRDAILKAAVEVFGKK--GYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK


General information:
TITO was launched using:
RESULT:

Template: 1ZKG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 173 -15825 -91.47 -310.29
target 2D structure prediction score : 0.69
Monomeric hydrophicity matching model chain A : 0.56

3D Compatibility (PKB) : -91.47
2D Compatibility (Sec. Struct. Predict.) : 0.69
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.264

(partial model without unconserved sides chains):
PDB file : Tito_1ZKG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1ZKG-query.scw
PDB file : Tito_Scwrl_1ZKG.pdb: